DPCstruct | MC8910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 127 ± 2 aa |
| Standard deviation of domain lengths | 1.74 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 74.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3I4J3 | 102-229 | KDVLGCTTEMDFFLWPRNDLQSIQCLLFSRWKGENDLAFKPLKVDFIFECIEYEKQLLRLVSGKEKTGLIISNPSQSMFLFVDRYPV… |
| A0A061HUU7 | 1-126 | MRLQKRLFCTQCWCASYSGSLVAGGYHSPAGTDGGIHGPVQTKFEFHHGDYEKQFLHVLSRKDKTGIVNNPNQSVFLFIDRQHLQTP… |
| A0A5F8G3L2 | 73-200 | None |
| A0A093PZK9 | 108-236 | None |
| S4RRR1 | 1-129 | None |
| A0A060YCE6 | 22-150 | None |
| A0A091WG89 | 102-229 | None |
| A0A0Q3MCB0 | 103-229 | None |
| A0A5N4CSX8 | 94-216 | None |
| A0A2J8S4R2 | 74-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.