DPCstruct | MC891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 3 aa |
| Standard deviation of domain lengths | 3.31 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9XHM3 | 11-107 | PLLIHRLGERLLRNLSHLLDRAPPGKGWRDLAQLSGSRGGVRLSPLELEECSLDVLAPEGSPSWSLLQLMGERGCTVAELTELLQSL… |
| A0A060W010 | 1-99 | MTGDWNGTLSEGARNRLADMLDNAKCGWRQLANVITAISIPLQNDMISCSFQILSPTGSPGRYLLERLSERSFTLGFLLHCLKTMEH… |
| A0A1A8ATL2 | 1-102 | None |
| A0A6I9PWK1 | 2-98 | None |
| A0A834F4S0 | 2-100 | None |
| A0A0P7XVC3 | 1-103 | None |
| A0A3B3SBW0 | 25-125 | None |
| A0A4W3HKN1 | 9-104 | None |
| A0A0P7TWF0 | 2-104 | None |
| H3DDQ7 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.