DPCstruct | MC8909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 7.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7C5P2 | 8-83 | PGPAAECYELLHLLSRRPMPVVYSAPEDIHKILALRSASLLEALTDPSVTLRSGERRIPRAIVTGLTAEGRAVCMS |
| A0A2N4SFU4 | 73-149 | DATPGDPMPMHLLSRLCCARLPLLIDDQAEIQMCDVLRSAGLIEAELPPLLHQRGRVVYSGQATVMRVTPKGHAASG |
| A0A554S2H3 | 1-67 | None |
| A0A520E7R3 | 2-70 | None |
| A0A1H7ES01 | 1-83 | None |
| A0A519FCI7 | 37-119 | None |
| A0A318SQR1 | 1-70 | None |
| A0A840FJA0 | 72-154 | None |
| A0A2P8KFF9 | 1-69 | None |
| A0A6L9PYS4 | 27-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.