DPCstruct | MC8908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 352 ± 85 aa |
| Standard deviation of domain lengths | 84.94 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 85.26 |
| Assigned Pfam label(s) | CL0063- CL0219- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0A984 | 94-396 | RIVNISIDDNLVYIYRELEDGTIDTQVKQANYWIIGASKPAGKYITLEGSQPYKYLKEYSDYEDYKVARINCYKKKSDVYSISNLVE… |
| A0A2I0JBN6 | 39-404 | FSEGEKKLGWLLTFAPSSWEDPETSKVYSCIDLYFVTQDGTSFKSKYKFRPYFYAATKDKMEMDVEAYLRRKYESQVADIEIMEKED… |
| A0A3Q0J709 | 53-497 | None |
| A0A0D9XPV8 | 44-394 | None |
| A0A2H3BU34 | 107-529 | None |
| A0A6V7PRA0 | 406-871 | None |
| A0A842XA65 | 205-481 | None |
| Q74N74 | 22-349 | None |
| A0A372QNI6 | 2-356 | None |
| H3AKZ0 | 328-628 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.