DPCstruct | MC8903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2JKE6 | 81-179 | SNFDSDEIYPPVGSPCTLFSDELNRYMSYEVNGSCPDDELLAQKLLLKGCEPLPRRRCHPAAPPEYVEPYPIPESFWSTPSDSSVVW… |
| A0A2I0IGT3 | 29-120 | ESINPSIGMGCARMATYLDRFMTYKLHGTCPDDSELAHKLMAGGCDHCREEDAFQEHPLTTQNHSRSKALSGTKPSDHKIQWNQYKC… |
| A0A1E5W8K1 | 12-104 | None |
| A0A2R6RJ60 | 96-185 | None |
| A0A2R6PX16 | 44-132 | None |
| A0A811MSC5 | 803-891 | None |
| A0A843WI57 | 247-333 | None |
| A0A200Q102 | 1-72 | None |
| A0A314UJS4 | 179-269 | None |
| A0A067K880 | 12-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.