DPCstruct | MC8902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 6.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 68.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0IF81 | 1-114 | MSQWHHPPNVPPPYKGYRDEDWQDNDGALNTISMTHPRLPIEHPSCYVVNDSDCQPLQPGVWYYKFVEADHILFIVNRERAGVQFDL… |
| M1ACP6 | 169-278 | MSLWRHPPDVPPPYKGYRDEDWWDNDGALNTISMTHPRFPVEHPSQLVVKDSDCQPFLPGIWYYKIVEGDHILFIVNRERAGVQFDL… |
| Q8GXY1 | 110-223 | None |
| A0A835R9P1 | 647-750 | None |
| A0A2K1J401 | 1-97 | None |
| A0A7G2DWW2 | 744-857 | None |
| A0A5D2L3U9 | 198-308 | None |
| A0A540L9P8 | 185-283 | None |
| A0A287M7G8 | 222-326 | None |
| A0A6A3A3R1 | 164-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.