DPCstruct | MC8901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 125 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534LLU3 | 639-764 | IASALGIEKTLLGIDAVVGGKTTAKDVNEAAILRLLDRYPKAQLVVSPVGGQGFILGRGNLQVSPPVLRRIGTRNVTVVATPSKLVT… |
| A0A6F9ZWX4 | 30-155 | YRIGKKIGIDKTLLGIDAVYRMKQVGKDLDEKGLLELIERYRKAKLVVSPIGAQGFILGRGNLQISPEVVRRIGIENIIVVATPSKL… |
| A0A5B8S9V9 | 421-547 | None |
| A0A7Y6CEP3 | 175-302 | None |
| A0A3S2XPG2 | 324-433 | None |
| A0A662CGP2 | 119-244 | None |
| A0A2E6HJD4 | 506-630 | None |
| A0A2I0N641 | 521-647 | None |
| A0A850MV25 | 80-205 | None |
| A0A662IAQ0 | 246-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.