DPCstruct | MC890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 61.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YFT6 | 19-85 | LCIQVQMFVAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISAKGEDGDKYA |
| A0A060VXN1 | 23-84 | LQVLAVDNVNFSVYVENQTRGRDAMSRRQHRVYQLYSRTSGKHLQVMGRRISAKGDDGDKYG |
| A0A3L8RZT6 | 74-139 | None |
| A0A6P8SNL4 | 7-75 | None |
| A0A4Z2H0Y2 | 75-140 | None |
| A0A401RUQ3 | 2-61 | None |
| G3IBE9 | 17-82 | None |
| L5MBC7 | 15-72 | None |
| G1U373 | 41-111 | None |
| G1TGR6 | 3-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.