DPCstruct | MC89
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A639YGM4 | 3-109 | SDTLEQRIYELVRSHDGVYLFKKKELTPSTDLDSDLRLEDDEALALMDDFFTTFNVDKGNFSITTYYPPEPPLKHLLNPFRKNDIPQ… |
| A0A1I2Y3M1 | 4-101 | VDEILEFTRAYTSSNKVQEESDIYDDLDLAGDDFHDFIEHFAARYEVDLTAYLWYFHADEEGLNLGSWFFKPPYARVKRIPVTPKML… |
| A0A651F6N4 | 73-222 | None |
| F3LEG0 | 17-128 | None |
| A0A6P2VFT7 | 8-84 | None |
| A0A259TUE1 | 1-140 | None |
| V4QBW9 | 10-111 | None |
| A0A5B2VKA3 | 73-176 | None |
| A0A7U6IFK8 | 4-112 | None |
| A0A6P2TAR0 | 6-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.