DPCstruct | MC8899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 144 ± 12 aa |
| Standard deviation of domain lengths | 12.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 50.77 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF09328- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2PJQ9 | 1-131 | METCVQCLKSNHGKPITLVYGTVVDGSSEQGLEVLVPSSQTELNCCSCVPSNHIGMYPAANDVLTALLLALPPVTWSGIQEEKLLLE… |
| A0A0D3E6D1 | 1-158 | MDYEDILTYSAAKACCQGAEILSGCSSKGFCCQETCVKCVKGSGEAEGTVVTGVVVRNGNEQRVDLLVPATQNDCECGPKANYPAGE… |
| A0A2U1NG81 | 374-503 | None |
| A0A0A9F8D9 | 7-146 | None |
| A0A7N0TBM6 | 173-337 | None |
| A0A2H5NJD1 | 701-832 | None |
| M1ANJ2 | 99-231 | None |
| M1ANJ5 | 5-137 | None |
| A0A498JT65 | 343-486 | None |
| A0A2I0VC81 | 133-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.