DPCstruct | MC8897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 166 ± 25 aa |
| Standard deviation of domain lengths | 24.90 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5MAY9 | 2-151 | WSCAGCFCLFHIPCIQKWAKDSVFLLSSVTDEDFGKKDHPWPCPKCRYEYSPSQTPSRYVCYCGKVQDPPLDPWLLPHSCGLVCDRA… |
| A0A0D3DY72 | 150-322 | NRQRVASNTRPVNEWKRVVKEEKIVLTDPNLPQLVQEIQEKLVKSSIECMICYDKVIRSANIWSCSSCYSIFHIHCIKRWARAPTSI… |
| A0A7J8JZM2 | 1-241 | None |
| A0A820VW12 | 66-255 | None |
| A0A6A4JSJ5 | 72-197 | None |
| A0A0M8MYU6 | 1-152 | None |
| A0A7J6L108 | 309-459 | None |
| A0A482VCX9 | 4-132 | None |
| A0A7R8ZY77 | 37-236 | None |
| B9ESZ2 | 22-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.