DPCstruct | MC8895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0407 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377B8M7 | 2-64 | LGFLAARAVSGVETVADSYYARSLAVGEYRGVVTAIPDIARHTLHINLSAGLEPVAAECLAKM |
| A0A6A8VID1 | 7-83 | RPPYRWADTLNFLSARAIPGVERVERGAYLRTVWLLDKAGNPHYGWIRVTCRTQKGLLDVTLSDTLIPVSSQVLDRV |
| A0A370H0E2 | 192-256 | None |
| G5Q4L7 | 1-70 | None |
| A0A1B5EYC6 | 1-62 | None |
| A0A6L5G0X4 | 54-146 | None |
| A0A381G8L6 | 1-78 | None |
| A0A7W0VU73 | 53-126 | None |
| H3ZEE4 | 222-300 | None |
| A0A7W1R6C9 | 97-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.