DPCstruct | MC8893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 22.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 14.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A066S1L9 | 16-203 | RRSVVMLLIVTLTGCSGPLRTGLWKEPYYDETISGFYLNPKEGVLLISGEKYSYIIQCESLLCDYAQASRQLEMKTSFWGLTLNPEG… |
| A0A210A5B9 | 13-162 | ASPPHAEQWRSDTIKGLSLAEDSNGTKGYVFVGESLDYLLTTGGDEVVKMLNDPAIHGERITVSDNAKFILSSSNKNFSGAITLYYD… |
| A0A7W2X1R8 | 6-201 | None |
| A0A371YS04 | 25-212 | None |
| A0A4R1Y475 | 6-244 | None |
| A0A1D3DF10 | 9-199 | None |
| A0A3S4IFR6 | 12-166 | None |
| A0A553F819 | 2-165 | None |
| A0A660N262 | 73-257 | None |
| A0A495YRL7 | 4-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.