DPCstruct | MC8890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 48 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 54.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04362 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X1LMF1 | 1-49 | MARTVFCTRLQKEADGLDFQLYPGELGKRIFDNICKEAWAQWQTKQTML |
| A0A0E1SSK4 | 1-42 | MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGRM |
| A0A535UN69 | 1-50 | None |
| A0A448QZ25 | 1-37 | None |
| A0A090S384 | 1-50 | None |
| A0A2V9WWA0 | 2-50 | None |
| A0A0W0VHK8 | 31-80 | None |
| A0A6N7EU89 | 53-102 | None |
| A0A2X2C2S9 | 1-49 | None |
| A0A484ZAX0 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.