DPCstruct | MC889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3D0E2 | 14-127 | PPRNKKLLVLCTTSCREVLEDLKILSKFSAVLHVPNLSTPEHLLNVIEESDVFSKKQVQEIERYLHQHKARVFVGIRKLLGLIDMAR… |
| A0A060VU89 | 55-147 | TTSRKDVLQEMEMLDAFSTTIHIPNISRGEQLVEALEMLGSFQEKERADIAKAVKGQGVWIGIKKLTMLIEMAVQMDPEYRVSKFLT… |
| A0A2H1CFS3 | 5-98 | None |
| A0A3L8D9N7 | 33-119 | None |
| A0A1Y3ELN2 | 2-84 | None |
| A0A2I0T278 | 15-90 | None |
| T1GCV4 | 412-500 | None |
| A0A556TVN2 | 894-983 | None |
| A0A1W4V5E4 | 237-327 | None |
| A0A817SGN8 | 44-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.