DPCstruct | MC8889
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8RD58 | 72-207 | FMADGIVVAYRLNSEYLTAPYCGQQLRYSSSFVLVKSQCKPDPQKKKSWLEFYSLYMHLAPVADYPKSPCYKVRDGHNGILLRQYKN… |
| A0A5Y7VYN1 | 1-128 | MNEAVDFPVPFKGEQAVRCMADGEVVAYRINRDYLSMPWYWGDLRYSGSFVLVRHRVQSGKTPESGLTFYTLYMHLAPWLAYPEQDS… |
| A0A090SQ84 | 60-172 | None |
| K8BGH0 | 174-286 | None |
| A0A2R7RP38 | 226-349 | None |
| A0A855RQ53 | 56-166 | None |
| K8AJY4 | 1-125 | None |
| Q87UT9 | 217-348 | None |
| A0A634F1W1 | 86-192 | None |
| A0A2X4TKS3 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.