DPCstruct | MC8887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 275 ± 34 aa |
| Standard deviation of domain lengths | 33.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A374DIG1 | 97-387 | IEKAISFEKKSLQDFEEVIRQNPKIPDKFKPLMEEYCKCVFEKYPDVELRPFYQNLQSLEVVECTEDELLKVSWDVYSCGCYVKSEN… |
| R5JB94 | 36-306 | LNKQKHSDVYKIIDDFSATNIPLDTNLDNIEQILQNLSYPDELKEIIRTFKNYIEPVNFETCINRLGSLKINYVSLLHDIKKYSQNF… |
| A0A831ZYX7 | 9-263 | None |
| A0A353SZQ8 | 174-499 | None |
| A0A3D0XYB6 | 1-322 | None |
| R5VGB0 | 91-341 | None |
| R5VPT6 | 15-250 | None |
| A0A2M7V8E9 | 153-436 | None |
| R6YL17 | 5-238 | None |
| A0A0G1LH53 | 1-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.