DPCstruct | MC8886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 131 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349RG90 | 18-134 | TEEGRPLPDPNQMNPIVLALIGDSVFTFYVRMRLLSVSSHVQVIHTIAAKMVSAVMQAKAMHDMEAGLSEEEAFIVHRGRNAKSMAP… |
| R5J206 | 124-247 | YLNNLNMNSLALAYLGDATYELYIRKYLTKKGNYKVKDLQTMAVDYVSAKAQSNFLDKMIENNFLTEDELDIVKRARNHKVLSHPKN… |
| A0A1G9AJ50 | 44-179 | None |
| A0A645F9F4 | 2-102 | None |
| A0A7X8PT73 | 8-125 | None |
| A0A073CJ64 | 1-95 | None |
| A0A354AUG5 | 16-138 | None |
| A0A2V0PJ67 | 13-153 | None |
| A0A388KW69 | 235-364 | None |
| A0A381NYT9 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.