DPCstruct | MC8884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3YXX9 | 112-204 | RNILVPPVYNLKHLKVKLECLHCKFLEQLVGSLLWLSPHPNIISFIMKSEVKSLKFHYKDEEDVESWRRDLKEVTMENFEDTERTIL… |
| A0A1S4DK49 | 7-117 | PPLYATNNLHVDIEKRWKHLVVEVVDSLLWISPQLDTISFNEARVLKTLKFIHEDASNEDEKSCCASLPWKCWRHKLKQVKMQNFSC… |
| A0A803KMV2 | 146-270 | None |
| A0A5C7IHD6 | 223-327 | None |
| A0A803L4C9 | 1-143 | None |
| A0A5C7INP4 | 165-288 | None |
| A0A2C9UTF5 | 251-366 | None |
| A0A2G3A3Q3 | 210-327 | None |
| A0A2G3CP46 | 536-667 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.