DPCstruct | MC8883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 722 |
|---|---|
| Mean domain length (aa) | 236 ± 57 aa |
| Standard deviation of domain lengths | 57.01 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 74.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.69 |
| Pfam Score | 98.59 |
| Assigned Pfam label(s) | CL0020- CL0105- PF03004- CL0036- PF13960 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8B4A9 | 5-149 | IQPIDVWHSRGVRYHVQFNEFNQPIRKGGHILVRFLGSVAKDGTYCPIGEKNWHHVDAKLKTKIVMKMREHFVILEDEVYNTLALQR… |
| A0A1S4DGU4 | 11-250 | NKSKKGRGKYKSLQVDMKTKHGSKIPIVIPDDIMRAVGPGSRDIVNYCGLIMRSTISFRDGNWQAIIAKHGEAMWLKVKDKFEASGM… |
| A0A1R3KP73 | 403-728 | None |
| A0A1R3KPL4 | 15-304 | None |
| A0A1R3KPT5 | 847-1145 | None |
| A0A803Q2I8 | 8-233 | None |
| A0A5E4F371 | 2-227 | None |
| A0A6V7PEQ9 | 1-235 | None |
| A0A445CTZ0 | 63-359 | None |
| A0A445DGR6 | 1-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.