DPCstruct | MC8882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 281 ± 64 aa |
| Standard deviation of domain lengths | 63.96 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02825 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7T4T5 | 101-274 | DSEALEHEFSKPTTKEDRIVPTDGGRYDVNVDERVRRAVYWEEDVSVVRRCTWFFKGDGGVKLVPYKEEMAATLEAEFYSAVRQNQW… |
| A0A1S4DA03 | 34-327 | KGASDLLSPASEKSSSESSQLGEEYSVEEERVGVPVKGGLYEVDLVKRHCFPVYWTGENRRVLRGHWFARKGGLDWLPLREDVAEQL… |
| G0NSA1 | 130-486 | None |
| G0NS98 | 189-463 | None |
| A0A1J1ITY1 | 768-1089 | None |
| A0A0B1RXM7 | 6-280 | None |
| A0A3P7IXU6 | 7-215 | None |
| A0A095BY33 | 5-405 | None |
| M8BV90 | 191-508 | None |
| A0A3S3PKG0 | 284-528 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.