DPCstruct | MC8881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 53.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C9AAG2 | 11-138 | TRSLLGWFLQKVQDRIVMCTIRQLIVKLANKSRRSFQYVDKEELIIAHMDGGVDVFIKPPQGWPLSMSALKLVSLRSSDQNAKGISL… |
| A0A1S4D5M9 | 3-143 | ASRQAYSVAVLEDRCFLEWFVRRVQDRIVLCTLRQFLVKSSNNARHSFEYVDREEMIVAHMVGGIDAFIKPPQGWPLTSSGLTLISL… |
| A0A6A1VLJ4 | 54-184 | None |
| A0A2I0XJ73 | 232-381 | None |
| A0A6J1ITD7 | 201-324 | None |
| A0A834HPF1 | 516-643 | None |
| A0A453BUI1 | 18-156 | None |
| A0A834X3Q0 | 950-1076 | None |
| A0A803Q0W9 | 265-408 | None |
| A0A022QS02 | 160-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.