DPCstruct | MC8880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 65.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7HXD0 | 14-131 | KESFMKRYKPVWRFFLVFNIGLAGYMFAKERMRKLSVEDNKAAKPVEDSTAAVEMEPTVIEPVKVRDPIPAEQQQELFKWILEEKRK… |
| A0A1S4CU37 | 69-170 | ENQVTAYLVLRTKRKDVGTDAGEVSDSPSNSVSSAAAITAAPPVLPAIVHEPISGEQQRELFKWILEEKRKLKPKDPEEKRRTDDEK… |
| A9SHB9 | 227-371 | None |
| A0A2I0WMI7 | 11-116 | None |
| A0A4V4H8P7 | 15-118 | None |
| M1D797 | 34-147 | None |
| A0A2P5XF66 | 133-232 | None |
| A0A835RIJ9 | 95-205 | None |
| A0A6J0NTS6 | 20-123 | None |
| A0A7J7MBH5 | 84-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.