DPCstruct | MC888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 71.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060VTP2 | 23-75 | TGAIFEENAGRDDEIFQLAISDLSLNDDILQSEKITHSVKSIEANNPFQAVQE |
| A0A4W5M0N3 | 6-53 | ENAVRDDEVFQLAISDLSLNDDILQSEKITHSIKLVEANNPFQAVQED |
| A0A4W5KM03 | 6-61 | None |
| A0A6F9A782 | 1-55 | None |
| A0A3Q2P719 | 10-68 | None |
| A0A4U1EFC0 | 23-78 | None |
| A0A674I070 | 4-62 | None |
| A0A498MMQ4 | 17-71 | None |
| A0A6P7NEP4 | 20-71 | None |
| H0YY12 | 3-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.