DPCstruct | MC8879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.33 |
| Pfam Score | 95.74 |
| Assigned Pfam label(s) | CL0346- CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4C7F3 | 3-121 | RIKVHELREKSKTDLSTQLKDFKAELALLRVAKVTGGAPNKLSKIKVVRKSIAQVLTVISQKQKLALREAYKNKKFLPLDLRPKKTR… |
| A0A1S4CTP0 | 1-111 | MARIKVHELRGKSKTELLAQLKDLKAELALLRVAKVTGGAPNKLSKIKVVRLSIAQVLTVISQKQKTALREAYKNKKYLPLDLRPKK… |
| A0A5N4DF09 | 8-125 | None |
| T1H1Y9 | 2-77 | None |
| A0A2C9VN59 | 1-98 | None |
| A0A654HQK2 | 5-117 | None |
| A0A7S0MLB3 | 68-194 | None |
| A0A7S4U9G5 | 66-181 | None |
| A0A3Q7EB74 | 1-93 | None |
| A0A177B6I6 | 226-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.