DPCstruct | MC8871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 52.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5KUR6 | 1-88 | MDLSKSTSTSPSLPTPPSSPAKIQLVSKFVSDQLLDKFFDAKEFDFDYEQSGLWSPPMRRSAFLSSSGRILTEEEMLGKLRKVMDDRP |
| A0A5J5A1Z0 | 1-94 | MAISISEDSSPSSLSQASSPTSPTTVQLVSKTLSDRLLGKYFDALEFDFDYEQSGLWSPPIPRRVFLTSPGNICSNGEMLKKLKNAK… |
| A0A5E4G6M2 | 1-97 | None |
| A0A4Y7KQ32 | 142-229 | None |
| A0A4Y7J3V0 | 20-98 | None |
| A0A0K9QIU5 | 36-121 | None |
| A0A6P5S838 | 3-91 | None |
| A0A061F9F8 | 1-98 | None |
| A0A6J1FVV1 | 1-103 | None |
| A0A0L9TK63 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.