DPCstruct | MC887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 166 ± 20 aa |
| Standard deviation of domain lengths | 19.97 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A8BYC0 | 127-298 | QEPENSEAASSRPLSPGEQLDLMCRQEEELRASQTEPSDSDMERYMYYINNCIPISEMAPYLHQHTVNIMKLLPPEPEDNKRDFQVL… |
| A0A060VR07 | 19-162 | VEDSQPPTCGSPTATEKDILRYYYYIRNGIDTEHVAAMEDSWLENVLDLVPTHLKRLTRTIELLSDEMKEDYLLSVKKAIVDFVLRD… |
| A0A4W4DR62 | 95-287 | None |
| A0A2G8LGM5 | 65-214 | None |
| A0A1I8HZF9 | 2-136 | None |
| A0A091CW62 | 263-451 | None |
| A0A672RW76 | 122-287 | None |
| A0A1A8B6I8 | 55-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.