DPCstruct | MC8869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 176 ± 40 aa |
| Standard deviation of domain lengths | 40.05 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.01 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0004- CL0108- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I4KUY4 | 5-164 | VNYISMEFLIGRLTGNNLLNLGWYQEVGDVLKEHDINLTDLLEEEIDPALGNGGLGRLAACFLDSMATVGQSAIGYGLNYQYGLFRQ… |
| A0A5J4ZPG7 | 35-231 | FDDFEAYQALSHSVRDRLIERWHDTHLYFKKKDPKRLYFLSLEFLMGRSLSNSVINLGVRDQYADALSQLGFEFEVLAEQEGDAALG… |
| A0A498NZB0 | 1-139 | None |
| A0A0E3Q4L4 | 26-123 | None |
| A0A2C9CLB7 | 16-177 | None |
| A0A0N1PIH4 | 7-122 | None |
| A0A643C449 | 406-573 | None |
| A0A3S4JBD0 | 1-162 | None |
| A0A0D0SXB1 | 107-322 | None |
| A0A2A2K5I6 | 2-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.