DPCstruct | MC8868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 55.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287TJ47 | 1-110 | MGRKMIKCAASDLISQSFPSTPAQSCDASEEYEKYGVELLKSEASLQYLCNLPPHRYEAAYARDIPELITGDEFMKKYGDHNDAVTV… |
| A0A2J7ZLT5 | 49-152 | YGSVRVGAFMGLTIASSCSASQPDASGGPAAPAWGGYLARLSPSQLSQHYAAALPQCIRGADFLERFGTHHDAVTSIDPAKEYSVLQ… |
| A0A5D3CTV5 | 1-107 | None |
| A0A1U7VD01 | 301-418 | None |
| A0A287XGS2 | 61-167 | None |
| A0A438HWL9 | 101-212 | None |
| A0A166J8Q2 | 960-1071 | None |
| A0A453NA80 | 118-251 | None |
| A0A5D2Q3Q3 | 530-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.