DPCstruct | MC8867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 2 aa |
| Standard deviation of domain lengths | 2.29 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 79.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 63.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9TTZ7 | 25-135 | DATLLYKNKVWRLGVTPSESQIREITLWLSECHKDPIGLSTYSLSNTGFPGATTLGDTTCGMAVVRISSKDIVFWFRSHTTTEIRWG… |
| A0A2G2V123 | 190-300 | GAALYYRGKYYPLGVTPTEPQIKDIVEWLLTYHGDSTGLSTDSLADAGYPGAASLGDAVCGMAVAYVTSKDFLFWFRSHTAKEIKWG… |
| A0A6A6M0Z9 | 25-130 | None |
| A0A287SDB2 | 196-307 | None |
| A0A4Y7IM88 | 378-488 | None |
| A0A811QCH7 | 210-320 | None |
| A0A444ZXR0 | 21-135 | None |
| P25848 | 439-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.