DPCstruct | MC886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 257 ± 24 aa |
| Standard deviation of domain lengths | 24.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14776 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368HAJ2 | 233-468 | KWLRQLEGGHSLGKEIDTMADERRMLSRFGVWMMAALCPPNQNADPQAISYIMYNVFQWFATTALLPNDSMGASLEQLKTDFVCDWI… |
| A0A060VMR0 | 1-278 | MGNGFQQCNLLKEAEIHAELREFELNRRRQMGLSASHHSLDNIDFDNKEDDQHDQRLLSQFGIWFLVSLCTPSENTPTESLARLVSM… |
| A0A0P4WEN1 | 406-662 | None |
| A0A0P4W1S7 | 101-347 | None |
| G3NZK1 | 417-736 | None |
| A0A182IZ53 | 249-505 | None |
| A0A4C1UR16 | 2-243 | None |
| A0A0N5CRZ3 | 211-476 | None |
| A0A0N4UA33 | 304-555 | None |
| A0A7R8VFI2 | 252-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.