DPCstruct | MC8859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 199 ± 34 aa |
| Standard deviation of domain lengths | 34.20 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 57.89 |
| Assigned Pfam label(s) | CL0123- CL0229- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9AH75 | 329-444 | LRKKLLDAIVAKEDLRADIEELSATLKSTAEEIRGILQEDEQLLMTNGAVSLNVTLTICRGHLTSKGCVEETCQSLHICPKFPFGLC… |
| A0A667WWT8 | 2-170 | SEAEAAVLKLICANHGSMSVDDLEESVCVFNVRRIISNREKFVCCRSGGEHKVVAKTELRLCKAKVCQGCNNLHLCRKFLLGSCPSS… |
| A0A3B4DFS0 | 1-206 | None |
| A0A6A4VPJ8 | 256-446 | None |
| A0A6A4VJE2 | 30-192 | None |
| A0A6A4VAE1 | 461-636 | None |
| A0A6A4V4Q9 | 5-220 | None |
| A0A6A4UXJ6 | 324-532 | None |
| A0A6P8T093 | 3-213 | None |
| T1FQZ3 | 11-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.