DPCstruct | MC8858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 51.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13908 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W4ETA6 | 16-86 | LEPGTHETCLGYYDVSGQFDKEFECNNTDHRYCCGSCFLRFCCQFKVNRLNQRTCKNYNKPDWVKTMQRYS |
| A0A2I3TAH4 | 75-143 | APPPAELCHGYYDVMGQYDATFNCSTGSYRFCCGTCHYRFCCEHRHMRLAQASCSNYDTPRWATTPPPL |
| A0A6P7ILU5 | 58-131 | None |
| A0A7J6AD79 | 122-216 | None |
| A0A452J7D5 | 50-124 | None |
| A0A672HTR9 | 42-115 | None |
| A0A3M7PHT1 | 4-72 | None |
| A0A6J0ZAY2 | 228-312 | None |
| A0A3Q1GGP9 | 49-132 | None |
| A0A4W6FN51 | 125-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.