DPCstruct | MC8857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 59.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498MUH6 | 248-355 | VQVMKYSEQRIPTLNDYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFNTLGVMSEAAEDVATGAEVVDLLVAMCRAALESVRKSIIF… |
| A0A3B4X3A1 | 264-371 | VQIMRYAEQRMPTLNEYCVVCDEQHVFQNGPMLKPAVCTRELCVFSFYTLGVMSGATEDVATGAEVVDLLVAMCRAALQSSRKSIIF… |
| A0A673A505 | 209-315 | None |
| A0A672INE1 | 120-246 | None |
| A0A813PFV2 | 301-422 | None |
| A0A0S4JMD4 | 355-462 | None |
| A0A673GM42 | 10-117 | None |
| A0A818CB34 | 2-104 | None |
| A0A553MRL2 | 224-331 | None |
| A0A1U8CT67 | 1-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.