DPCstruct | MC8855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 221 ± 26 aa |
| Standard deviation of domain lengths | 25.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5Y960 | 8-252 | LLSSLKSPVYWIVVAIVIFQYKKLGKMEKMILGSYREPLYKKAIVSTVLGLLGGIVGSIVFMILGTRVNSSDFIYILPLAILLSLIH… |
| A0A1V2M1Z4 | 35-243 | KDVARGTIVGTMLSYFITSFGISFNLNFSMLMLIPITILFTAINPKWSCFAYVIPFNFFLGQLCEIFGYKFIIFDLPYTEFIVFIGM… |
| A0A859FGP3 | 61-300 | None |
| A0A660L1G7 | 94-309 | None |
| A0A5S9MHY6 | 2-222 | None |
| A0A1S9CI52 | 3-227 | None |
| A0A3D1QBC8 | 15-281 | None |
| A0A2S8PGB8 | 284-535 | None |
| A0A1U7M6W7 | 50-243 | None |
| A0A3D0Y7K4 | 4-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.