DPCstruct | MC8854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 16.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2TTL7 | 130-207 | TKQVIIRVKSGAVTPANVDRLYGVLDRYRGSADVLFEIECAGGILVRIRPNPFVKITPSPEALSEIRRHLEGCEIRLV |
| A0A1V2LXS5 | 9-85 | KTILTLKLYEEMRTAEIMQELLKIFKEYPGHSKIQVKYMEDGTIKFFPKKYNIKISEKIIHELTKIVGKECIVITKF |
| T2RF17 | 80-157 | None |
| R5C0S7 | 6-77 | None |
| A0A2D8Z8B2 | 71-147 | None |
| A0A2E4PS62 | 84-186 | None |
| A0A847ZI69 | 156-233 | None |
| A0A1W9UYU2 | 213-296 | None |
| A0A1C6IH14 | 76-144 | None |
| A0A7X6X9I0 | 45-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.