DPCstruct | MC8850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 142 ± 16 aa |
| Standard deviation of domain lengths | 16.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0220- PF13164 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7SGR5 | 1-137 | MKITNSFSSLCLMCLIIGLTFIKSTAAGCCPCNIYLTCGDQSGCTVYECCSTAACNIFCCNCDGPCKGGKSTELSDAKTENICLSKF… |
| A0A166LV87 | 3-134 | QRAFVSLIATLLLLSYTSAECCTPDGSALCADGTYGFPCCGKGACNIFCCECDGGCRTSDSRASLSARNPLGVVEADSCKQRFSQAD… |
| A0A6J8E1X1 | 1-151 | None |
| A0A164RKK9 | 12-150 | None |
| A0A1S3IUT0 | 4-157 | None |
| C3YUZ7 | 1-173 | None |
| A0A5N5CWB6 | 12-128 | None |
| A0A177CEE3 | 13-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.