DPCstruct | MC885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 51.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401PF94 | 144-238 | DGFPDALAILKNTSGSNKQAFLLENVPCNDASCKAVGRMFKVLWELSDLNQIKNAVVATFFDIYEDGILDLLVLNKNKKTAEFTIHA… |
| A0A060VM53 | 1-113 | MDGFPDALVILRNTSGSGQQAFLLENVPCDNASCKDVGRMFRVHWDQSDLGAIPGAAVATFFDIYEDGILDMIVLSKEEGKEGFIIH… |
| A0A2K6GQH1 | 167-260 | None |
| A0A3Q1GCW1 | 104-218 | None |
| A0A818CLW3 | 1-101 | None |
| A0A817M3R0 | 4-95 | None |
| A0A210R2L7 | 179-275 | None |
| A0A803V3S2 | 224-316 | None |
| A0A6J2TJB6 | 63-167 | None |
| A0A674EZH8 | 200-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.