DPCstruct | MC8849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 149 |
|---|---|
| Mean domain length (aa) | 160 ± 30 aa |
| Standard deviation of domain lengths | 29.73 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C3KQK7 | 76-249 | AELQHELRRLREEIRQLQRNCPASVGYSDANAVKITNALGETFSVPWELVRSQEDMHYIMMKHFAGKPGERRVAERRYCISRQDDGS… |
| A0A166LHK5 | 11-185 | KFYAQLEQESTSLRYIEVDAVIVKDHLWRNLYVPMIFCTSSQDFHVVIAGFCRGVAGDSLIRRGNYRILNSEDDQVINPEEFAIILR… |
| A0A165XRB6 | 359-553 | None |
| A0A194XFK6 | 15-136 | None |
| A0A165ZWL1 | 9-209 | None |
| A0A166BRP3 | 260-424 | None |
| A0A166DF46 | 475-671 | None |
| A0A0C3BRF0 | 2-167 | None |
| A0A4Y7TVE8 | 35-232 | None |
| L2GGZ3 | 114-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.