DPCstruct | MC8846
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 75.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N9VVU2 | 72-160 | LYREILTDACDKMKVNYNSKSSVETIEMNLLMKILEKSLEKMTPDQLKTVAEELQTGYSNPTPELLTMAIQAGIKTSGFAAYQMALV… |
| A0A2A6SWW7 | 2-93 | CDACDHLKVNYNEKSPTSLIEKNMLSKLLKDSLEKMSKKDLEELGHELGMSNIDKMISENKQLLIASVLTLFKAGGSHSYALAVSVA… |
| A0A293TK95 | 2-79 | None |
| A0A2T6U1Y3 | 35-140 | None |
| A0A518YH20 | 10-94 | None |
| M3N1R0 | 16-106 | None |
| A0A7K1MX69 | 89-180 | None |
| A0A2T6P797 | 10-107 | None |
| T2SDT2 | 25-115 | None |
| M3PNB7 | 22-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.