DPCstruct | MC8845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 338 ± 33 aa |
| Standard deviation of domain lengths | 32.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3KN88 | 3-304 | PRISPSSLMVSDFPERLTTDGVLFTADLHRQAPSRFLYFHYNPPHSIARRIVLRATNTSPEPALLQFIDGRGGPSPNEMEAGHLSTK… |
| A0A0Q8GLF2 | 34-376 | GYGGYPIWKSNNPEIFRGTGWLMQDARVDSTRGGSAYALPGCHNAYLFHINQKGSAGTLHLIATNPNNATITVSAKGSMYTNAQKPL… |
| A0A1M4ST69 | 146-536 | None |
| A0A7X8XPM7 | 19-389 | None |
| A0A1H2QV80 | 708-1034 | None |
| A0A5C4TFI4 | 19-390 | None |
| A0A7V1REB3 | 304-616 | None |
| A4J2I4 | 14-383 | None |
| E6Q3L3 | 220-554 | None |
| A0A399F8L8 | 47-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.