DPCstruct | MC8844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 265 ± 43 aa |
| Standard deviation of domain lengths | 43.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3VYE9 | 118-404 | DGRPALGLLPRDLLTLIKSIDERSFLIPAHLWTPWFGLYGSKSGYDSLEECFGSLAGEIPAIETGLSSDPAMNWRVPSLDNVAIMSF… |
| A0A2M8L3R8 | 10-294 | LSARDLAALILDTSPQALIVPAHAWTPHFSLYGSESGFDSLSECFGDMAKNIYAIETGLSSDPAMNWRIGELDNRSIISCSDAHSGA… |
| X1KTW1 | 1-195 | None |
| A0A1W9SI97 | 142-415 | None |
| A0A3C0UCY1 | 51-307 | None |
| A0A352UFC1 | 1-278 | None |
| A0A7C1SMM3 | 1-195 | None |
| F5YDZ3 | 143-440 | None |
| A0A7J4G5Q6 | 112-321 | None |
| A0A1V4QLF4 | 135-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.