DPCstruct | MC8843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 251 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 30.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0P4Q8 | 26-267 | KATEEVRTLRETNSIKERTLSLLDTPLAELEQAIANEERKLAQLQSEWGEHRAPLAAEIDEHEATMQERRERAAAKLAQVRALRAEV… |
| A0A2Z7B7D3 | 5-226 | IDELNYQVQEKKSKLEELESEWDADVNVLQEKKRNIEQSLQVLYPEVYSKLTRIKEIKLETQAVETEIKRREDEIVKLSSDIGKHPK… |
| A0A820ZDE2 | 2-221 | None |
| A0A7R9Y989 | 106-388 | None |
| A0A6J1W6J2 | 67-317 | None |
| D3B059 | 711-964 | None |
| A0A0T6BH13 | 26-280 | None |
| A0A6S7P2K0 | 139-402 | None |
| A0A0L0DRS8 | 307-554 | None |
| A0A6N2NAN2 | 245-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.