DPCstruct | MC8841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 144 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5JPH4 | 60-209 | LPDIPKLPSSRPAPKSFKQVKAEPEAKNEHVSDVIAQLTLWLKKNWSVLLFNCGSVCTLIGYTRSDVLELRMFAIAGTLSGLIYSIV… |
| A0A7S0P3R0 | 11-154 | RLSLRPSTGSASSYLGLVSMLTLLWTRLRHAVPPSKLNYVSHVANGFAVLGSMSDDMLYLRSFMIAATSCNMSYNFLQPKPLMTPVY… |
| A0A5A8DMD8 | 3-145 | None |
| R1F905 | 51-199 | None |
| A0A7S2RMN7 | 3-148 | None |
| A0A812I996 | 6-150 | None |
| A0A5A8D3W6 | 3-145 | None |
| A0A7S1ADX0 | 1-127 | None |
| A0A812TM52 | 557-711 | None |
| A0A0M0J3F4 | 31-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.