DPCstruct | MC8840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 101 ± 4 aa |
| Standard deviation of domain lengths | 3.88 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0F782 | 75-173 | EAPEFPLSAGRYLVTGGRMTTTGLTVDAAGNWKLDEGTLYDVTHLPCRSARYSPAPGQNGSPLTANQRDFPVSPGAIMPSVEGCNKQ… |
| A0A7S0P252 | 20-115 | RLIAPEKRYVVTGDRDITAVLTVRADGRWELSKGTLYDVTHLPCRTGVYTPTASDSCKPLASMQGAFPVKPGARMPTFDGCATVDRA… |
| A0A7S0PWK1 | 98-198 | None |
| A0A7S3VEC3 | 185-284 | None |
| A0A1E4ZUP6 | 1-111 | None |
| A0A2E1V6A3 | 114-218 | None |
| A0A3S2WUV6 | 50-151 | None |
| A0A7S2TMQ2 | 1-100 | None |
| A0A812Y0C7 | 154-254 | None |
| A0A1Q9C6M4 | 215-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.