DPCstruct | MC884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 160 ± 19 aa |
| Standard deviation of domain lengths | 19.28 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 17.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07331 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8LZ17 | 9-187 | LPRGGTPMEKKDLTSGIALVLTGAAFFAGSLLLPWKDTGYDWFGAPGLVPAILAVLIALCGLRLVIRSRKEPDFYARLAAGENPLLC… |
| A0A2S5PEN4 | 9-180 | DGPSLVSNRIVEIIVALLFLLCSTIVIIDSVRLGFGWIEGEGPAPGYFPFYIAVFMAVASLATLLQAVAGTIKDGGASFVSVIGFGR… |
| A0A163ULB2 | 14-188 | None |
| A0A1Y4LUX4 | 69-228 | None |
| A0A6I1R8I0 | 20-189 | None |
| A0A2E9NSS3 | 39-190 | None |
| A0A3Q9B6N6 | 3-173 | None |
| A0A2E1BBR7 | 41-221 | None |
| A0A7C4LZA5 | 15-170 | None |
| A0A2E2RWG0 | 2-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.