DPCstruct | MC8837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1FI33 | 64-195 | RIPSAGVQVINAKTGGQLSCLVEGQDEDTVRAEITDPSLGRVLRRIVTQCCKPNVAGSGACVRVYNRGRSCTSGKPPAEPITKRTYA… |
| A0A7S0NTM2 | 9-154 | PPPKSIIPAGGIKILHGGPKQDPDKKGVQLACLVAGQEGEQQVTAPFPTATSTNMMTIALQCCKKSDTPGGLDTCFRWIGSMPDGCV… |
| A0A7S0L3H9 | 10-145 | None |
| R1BWA1 | 3-137 | None |
| A0A7S4A7Y6 | 133-286 | None |
| A0A7S0IRK2 | 219-373 | None |
| A0A7S0IRB9 | 420-570 | None |
| A0A7S0IPY0 | 3-136 | None |
| A0A7S0IVP1 | 66-204 | None |
| A0A7S0P4N1 | 20-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.