DPCstruct | MC8834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 307 ± 29 aa |
| Standard deviation of domain lengths | 28.58 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812P455 | 358-653 | RAAQFRAFFLYHYWPCDKSIFQMYMHEPIDICLLLLSLSPFVFVRVLFYTVLLLCLCVPWPPDEHQIVQFILACKGTAIISDGAGRV… |
| A0A7S0JGZ4 | 153-499 | HPFLWFRAVFLYSQVPADCTFVMKLQNPFYVFLLLLKLSGTTVSVLVYAVYFLLTDWNDEYQMVAFILKFKGFQFLSPGIFHSITVA… |
| A0A0V0QKZ8 | 142-507 | None |
| A0A7S2BUC5 | 14-315 | None |
| A0A7S1SBL8 | 45-350 | None |
| A0A812KPC1 | 98-381 | None |
| R1E2A5 | 358-719 | None |
| A0A7R9ZVL2 | 2-274 | None |
| R1F5D2 | 91-397 | None |
| A0A7S0JC22 | 12-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.