DPCstruct | MC8832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 195 ± 31 aa |
| Standard deviation of domain lengths | 30.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 64.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06916 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8BX69 | 115-325 | STLHLMRTSSKSKVYFSSLGTMSSSNHSTSTKPSSGNDSVKDESNKTDITKQLSTKEKVKLLFKKYGFVFVGTYMSIYFATLLSIFG… |
| A0A010RU17 | 224-426 | TLASNISKTWRIAIPIPLVAKSDFKLDHVSARNDLPVITPDVPESLSLSQRLKKLSREYGWSAVGVYLALSVLDFPFCFLLVRIVGT… |
| A0A366RC90 | 3-183 | None |
| A0A3N4ISH2 | 23-217 | None |
| A0A1A5ZV51 | 1-270 | None |
| H2AZS4 | 1-190 | None |
| A0A0M8MQ01 | 2-138 | None |
| A0A2J6QBK8 | 53-259 | None |
| A0A0W4ZV03 | 68-203 | None |
| A0A1R0H0L7 | 89-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.