DPCstruct | MC883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 449 ± 99 aa |
| Standard deviation of domain lengths | 99.48 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 73.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 26.96 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0001- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819MK66 | 628-1082 | LAWLGNDTFTVLIPSQVLFYLTKFTLLSTFPNKWKKLCATMVLNFNTIAWSNAIGLAIVDVNESVYIIRPTTPGYYSVTNTGCGEGI… |
| A0A1R2APF7 | 6-660 | KLYFIGGQSYSGSNFDLWEYDLSTNNLTRLYKTKPTDIGTHGHACQLIKEGNSSLIYTLYGMTNKMNDLYCKIRMIDITETDKITVK… |
| A0A820T845 | 90-562 | None |
| A0A818ZA20 | 1-326 | None |
| A0A813UAK3 | 560-1016 | None |
| A0A819BJT8 | 324-771 | None |
| A0A821RIR5 | 46-477 | None |
| A0A816U7M4 | 3-364 | None |
| A0A821K5N0 | 91-368 | None |
| A0A820YP09 | 48-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.